| Edit |   |
| Antigenic Specificity | PRAS40 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PRAS40 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRAS40. This antibody reacts with human. The PRAS40 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
| Immunogen | Synthetic peptides corresponding to AKT1S1(AKT1 substrate 1 (proline-rich)) The peptide sequence was selected from the C terminal of AKT1S1. Peptide sequence KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAE. |
| Other Names | 40 kDa, AKT1 substrate 1 (proline-rich), MGC2865, proline-rich AKT1 substrate 1,40 kDa proline-rich AKT substrate |
| Gene, Accession # | AKT1S1, Gene ID: 84335, Accession: Q96B36, SwissProt: Q96B36 |
| Catalog # | NBP1-55261 |
| Price | |
| Order / More Info | PRAS40 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |