| Edit |   |
| Antigenic Specificity | PRDM13 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PRDM13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRDM13. This antibody reacts with human. The PRDM13 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human PRDM13. Peptide sequence HGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRM. |
| Other Names | PR domain containing 13, PR domain zinc finger protein 13 |
| Gene, Accession # | PRDM13, Gene ID: 59336, Accession: NP_067633, SwissProt: NP_067633 |
| Catalog # | NBP1-80360-20ul |
| Price | |
| Order / More Info | PRDM13 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |